ABclonal
Recombinant Human CX3CL1/Fractalkine Protein - RP01711
Recombinant Human CX3CL1/Fractalkine Protein - RP01711
Couldn't load pickup availability
Recombinant Human CX3CL1/Fractalkine Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01711-10, RP01711-20, RP01711-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CX3CL1/Fractalkine Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln25-Gly100) of human CX3CL1/Fractalkine (Accession #NP_002987.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
SWISS: P78423
GeneID: 6376
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fractalkine or Chemokine (C-X3-C motif) ligand 1 (CX3CL1) is a member of the CX3C chemokine family. Fractalkine / CX3CL1 is a unique chemokine that functions not only as a chemoattractant but also as an adhesion molecule and is expressed on endothelial cells activated by proinflammatory cytokines, such as interferon-gamma and tumor necrosis factor-alpha. Fractalkine/CX3CL1 is expressed in a membrane-bound form on activated endothelial cells and mediates attachment and firm adhesion of T cells, monocytes and NK cells. Fractalkine / CX3CL1 is associated with dendritic cells (DC) in epidermis and lymphoid organs. The fractalkine receptor, CX3CR1, is expressed on cytotoxic effector lymphocytes, including natural killer (NK) cells and cytotoxic T lymphocytes, which contain high levels of intracellular perforin and granzyme B, and on macrophages. Soluble fractalkine causes migration of NK cells, cytotoxic T lymphocytes, and macrophages, whereas the membrane-bound form captures and enhances the subsequent migration of these cells in response to secondary stimulation with other chemokines.
Source: Pichia
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
