WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein - RP01933

Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein - RP01933

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01933-10, RP01933-20, RP01933-50, RP01933-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys39) of Human CXC-chemokine receptor 1/CXCR1 (Accession #NP_000625.1) fused with hFc tag at the C-terminus.

Alternate Names: CXCR1, CMKAR1, IL8RA, C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181

SWISS: P25024

GeneID: 3577

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Human CXC-chemokine receptor 1/CXCR1, Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor.Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only