Skip to product information
1 of 1

ABclonal

Recombinant Human CXCL1/GRO-alpha Protein - RP01623

Recombinant Human CXCL1/GRO-alpha Protein - RP01623

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CXCL1/GRO-alpha Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01623-10, RP01623-20, RP01623-50, RP01623-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO-alpha (Accession #NP_001502.1) fused with and a hFc tag at the C-terminus.

Alternate Names: CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1, GRO alpha

SWISS: P09341

GeneID: 2919

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details