WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL10/IP-10 Protein - RP01638

Recombinant Human CXCL10/IP-10 Protein - RP01638

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL10/IP-10 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01638-10, RP01638-20, RP01638-50, RP01638-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL10/IP-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Pro98) of Human CXCL10/IP-10 Protein (Accession #NP_001556.2) fused with His tag at the C-terminus.

Alternate Names: CXCL10, INP10, SCYB10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Gamma-IP10, IP-10, Small-inducible cytokine B10, Cleaved into: CXCL10(1-73)

SWISS: P02778

GeneID: 3627

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: C-X-C Motif Chemokine Ligand 10 (CXCL10) is a pro-inflammatory chemokine secreted by a wide spectrum of cells. It is involved in multiple mechanisms and reported to have pleiotropic effects, including immune cell migration and attraction to inflammation sites, angiogenesis, and cancer cell growth. CXCL10 is produced by pancreatic islet cells upon inflammatory stress and is specifically recognized by C-X-C Motif Chemokine Receptor 3 (CXCR3) which is expressed by activated T-lymphocytes and other immune cells.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only