Elabscience
Recombinant Human CXCL13 protein(N-His)(active) - PKSH034197
Recombinant Human CXCL13 protein(N-His)(active) - PKSH034197
Couldn't load pickup availability
Recombinant Human CXCL13 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSH034197-20, PKSH034197-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL13
Target Symptom: B-cell Attracting Chemokine-1; BLR1 Ligand; BCA-1/BLC
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: O43927
Accession: O43927
Background: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED50 for this effect is < 20 ng/mL.
Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 13.49 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
