WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL13 protein(N-His)(active) - PKSH034197
Recombinant Human CXCL13 protein(N-His)(active) - PKSH034197

Recombinant Human CXCL13 protein(N-His)(active) - PKSH034197

Regular price
$348.60
Regular price
Sale price
$348.60
Unit price
per 
Availability
Sold out

Recombinant Human CXCL13 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSH034197-20, PKSH034197-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: CXCL13

Target Symptom: B-cell Attracting Chemokine-1; BLR1 Ligand; BCA-1/BLC

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: O43927

Accession: O43927

Background: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED50 for this effect is < 20 ng/mL.

Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 13.49 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only