ABclonal
Recombinant Human CXCL14/BRAK Protein - RP02782
Recombinant Human CXCL14/BRAK Protein - RP02782
Couldn't load pickup availability
Recombinant Human CXCL14/BRAK Protein
Sizes: 10ug, 20ug
Catalogue Number: RP02782-10, RP02782-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CXCL14/BRAK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of human CXCL14/BRAK (Accession #NP_004878.2) fused with a His tag at the C-terminus.
Alternate Names: KEC; KS1; BMAC; BRAK; NJAC; MIP2G; MIP-2g; SCYB14; CXCL14
SWISS: O95715
GeneID: 9547
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CXCL14 is a CXC chemokine family that exhibits antimicrobial activity and contains an amphipathic cationic alpha-helical region in the C-terminus, a characteristic structure of antimicrobial peptides (AMPs). CXCL14 is involved in cell recruitment, migration, activation, and homing in liver diseases and have been shown to be upregulated during acute liver injury in animal models. The CXC chemokine ligand 14 (CXCL14) had been show highly expressed in tumor-associated stromal cells, promoting tumor cell growth, and invasion.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
Antigen Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
