WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL14/BRAK Protein - RP02782

Recombinant Human CXCL14/BRAK Protein - RP02782

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL14/BRAK Protein

Sizes: 10ug, 20ug

Catalogue Number: RP02782-10, RP02782-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL14/BRAK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of human CXCL14/BRAK (Accession #NP_004878.2) fused with a His tag at the C-terminus.

Alternate Names: KEC; KS1; BMAC; BRAK; NJAC; MIP2G; MIP-2g; SCYB14; CXCL14

SWISS: O95715

GeneID: 9547

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CXCL14 is a CXC chemokine family that exhibits antimicrobial activity and contains an amphipathic cationic alpha-helical region in the C-terminus, a characteristic structure of antimicrobial peptides (AMPs). CXCL14 is involved in cell recruitment, migration, activation, and homing in liver diseases and have been shown to be upregulated during acute liver injury in animal models. The CXC chemokine ligand 14 (CXCL14) had been show highly expressed in tumor-associated stromal cells, promoting tumor cell growth, and invasion.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.

Antigen Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only