WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL2/MIP-2 Protein - RP01656

Recombinant Human CXCL2/MIP-2 Protein - RP01656

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL2/MIP-2 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01656-10, RP01656-20, RP01656-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL2/MIP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL2/MIP-2 (Accession #NP_002080.1) fused with no additional amino acid.

Alternate Names: GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; CXCL2

SWISS: P19875

GeneID: 2920

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.

Source: Pichia

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only