Skip to product information
1 of 1

ABclonal

Recombinant Human CXCL2/MIP-2 Protein - RP01857

Recombinant Human CXCL2/MIP-2 Protein - RP01857

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CXCL2/MIP-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01857-10, RP01857-20, RP01857-50, RP01857-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL2/MIP-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of Human CXCL2/MIP-2 (Accession #NP_002080.1) fused with No tag.

Alternate Names: CXCL2, GRO2, GROB, MIP2A, SCYB2, C-X-C motif chemokine 2, Growth-regulated protein beta, Gro-beta, Macrophage inflammatory protein 2-alpha, MIP2-alpha, Cleaved into: GRO-beta(5-73), GRO-beta-T, Hematopoietic synergistic factor, HSF, SB-251353

SWISS: P19875

GeneID: 2920

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CXCL2 is a chemokine induced by endotoxin and serves as an extremely potent chemo-attractant for neutrophils, acting as a crucial inflammatory mediator. CXCL2 could be produced by multiple, different cell types, including macrophages and cancer cells. CXCL2 is involved in cancer metastasis, angiogenesis, and wound healing.The amino acid sequence of human CXCL2 protein has low homology between mouse and rat CXCL2 protein.CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 binds to the G-protein coupled receptor CXCR2 (IL-8RB) expressed on macrophages, neutrophils, and epithelial cells and its classical function is to act as chemotactic factors attracting neutrophils to sites of injury.In enterocytes, LPS induces CXCL2 expression and promotes migration of neutrophils in a model of platelet-activating factor induced shock and bowel injury. In acute lung injury, CXCR2 ligands, including CXCL1/2/3, have chemotactic effects for polymorphonuclear leukocytes. CXCL2 could provoke a dose-dependent increase of colorectal tumor cell migration in vitro. Further, according to Bachmeier et al., CXCL-1 and −2 silencing could down-regulate several metastasis-promoting genes and inhibit the metastatic potential of breast cancer cells.

Source: E.coli

Tag: No-Tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mMTris,500mMNaCl,pH8.0

Antigen Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details