ABclonal
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein - RP01403
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein - RP01403
Couldn't load pickup availability
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01403-10, RP01403-20, RP01403-50, RP01403-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL3/GRO gamma (Accession #NP_002081.2) fused with no additional amino acid.
Alternate Names: CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
SWISS: P19876
GeneID: 2921
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CXCL3 is involved in migration, invasion, proliferation and tubule formation of trophoblasts and may play a key role in the pathogenesis of preeclampsia. CXCL3 autocrine/paracrine pathways are involved in the development of prostate cancer by regulating the expression of the target genes that are related to the progression of malignancies. CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
