WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL5/ENA-70 Protein - RP00351

Recombinant Human CXCL5/ENA-70 Protein - RP00351

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL5/ENA-70 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00351-10, RP00351-20, RP00351-50, RP00351-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL5/ENA-70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala37-Asn114) of human CXCL5/ENA-70 (Accession #P42830) fused with a His tag at the c-terminus.

Alternate Names: CXCL5, ENA-78, SCYB5

SWISS: P42830

GeneID: 6374

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein belongs a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20 mM Sodium Citrate,150 mM NaCl, pH5.0.

Antigen Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only