Recombinant Human CXCL6 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSH034194-20, PKSH034194-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL6
Target Symptom: Granulocyte Chemotactic Protein-2; GCP-2
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P80162
Accession: P80162
Background: Chemokine (C-X-C-Motif) Ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. It is a potent neutrophil chemotactic and activating factor and it exhibits extensive similarity to other CXC chemokines such as IL-8 and ENA-78. CXCL6 can promote the release of MMP-9 from granulocytes indicating its potential role as an inflammatory mediator. It functionally uses both of the IL-8/CXCL8 receptors to chemoattract neutrophils but that is structurally most related to epithelial cell-derived neutrophil attractant-78 (ENA-78)/CXCL5. The human CXCL6 gene has been cloned and is physically mapped to the CXC chemokine locus on chromosome 4. Mature human CXCL6 is a 75 amino acid (aa) protein with a predicted molecular weight of approximately 8 kDa. Human CXCL6 shares 60% and 67% aa identity with mouse and bovine CXCL6, respectively.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 10 ng/mL.
Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 12.72 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only