Skip to product information
1 of 1

ABclonal

Recombinant Human CXCL9/MIG Protein - RP00352

Recombinant Human CXCL9/MIG Protein - RP00352

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CXCL9/MIG Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP00352-10, RP00352-50, RP00352-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL9/MIG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr23-Thr125) of human CXCL9 (Accession #Q07325) fused with no additional amino acid.

Alternate Names: CXCL9, CMK, Humig, MIG, SCYB9, crg-10

SWISS: Q07325

GeneID: 4283

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This antimicrobial protein belongs a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details