ABclonal
Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein - RP00136
Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein - RP00136
Couldn't load pickup availability
Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00136-10, RP00136-20, RP00136-50, RP00136-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn19-Pro152) of human CD28/TP44 (Accession #NP_006130.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD28, Tp44
SWISS: P10747
GeneID: 940
Species: Human,Cynomolgus,Rhesus macaque
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human CD28 Protein at 1 μg/mL (100 μL/well) can bind CD28 Rabbit mAb with a linear range of 0.06-1.04 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
