Skip to product information
1 of 1

ABclonal

Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein - RP00136

Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein - RP00136

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00136-10, RP00136-20, RP00136-50, RP00136-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn19-Pro152) of human CD28/TP44 (Accession #NP_006130.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD28, Tp44

SWISS: P10747

GeneID: 940

Species: Human,Cynomolgus,Rhesus macaque

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human CD28 Protein at 1 μg/mL (100 μL/well) can bind CD28 Rabbit mAb with a linear range of 0.06-1.04 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details