WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Cystatin-D/CST5 Protein - RP01035

Recombinant Human Cystatin-D/CST5 Protein - RP01035

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Cystatin-D/CST5 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01035-10, RP01035-20, RP01035-50, RP01035-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Cystatin-D/CST5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Val142) of human Cystatin D (Accession #NP_001891.2) fused with a 6×His tag at the C-terminus.

Alternate Names: CST5, MGC71922, CST5

SWISS: P28325

GeneID: 1473

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Cystatins are natural inhibitors of papain-like (family C1) and legumain-related (family C13) cysteine peptidases. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. As a member of type 2 cystatin, cystatin D is a single-domain protein and also has cysteine residues that form disulfide bridges. The functions of Cystatin D are largely unknown. However, Cystatin D has been shown to inhibit coronavirus replication at its physiological concentration (0.12_x005f

Bio-Activity: Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AM. The IC50 value is <18 nM.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only