ABclonal
Recombinant Human Cystatin-M/CST6 Protein - RP00236
Recombinant Human Cystatin-M/CST6 Protein - RP00236
Couldn't load pickup availability
Recombinant Human Cystatin-M/CST6 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00236-10, RP00236-20, RP00236-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Cystatin-M/CST6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg29-Met149) of human CST6 (Accession #NP_001314.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CST6
SWISS: Q15828
GeneID: 1474
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cystatin E/M encoded by the CST6 gene is a member of family 2 of the cystatin superfamily. It inhibits papain and cathepsin B, two of the cysteine proteases. Its mRNA was found in many tissues by the two groups who did initial cloning. However, its protein was found only in skin and sweat glands by a third group. In addition to being a cysteine protease inhibitor, cystatin E/M is also a substrate for transglutaminases. It is required for viability and for correct formation of cornified layers in the epidermis and hair follicles, as ichq mice, with a null mutation in the cystatin E/M gene, have defects in epidermal cornification and die between 5 and 12 days of age. Cystatin E/M expression and function may not be limited to cutaneous epithelia. For example, it is found in rat brain and is induced during neuronal cell differentiation.
Bio-Activity: Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC50 value is approximately 16 nM.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
