ABclonal
Recombinant Human Cystatin-SN/CST1 Protein - RP00100
Recombinant Human Cystatin-SN/CST1 Protein - RP00100
Couldn't load pickup availability
Recombinant Human Cystatin-SN/CST1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00100-10, RP00100-20, RP00100-50, RP00100-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Cystatin-SN/CST1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp21-Ser141) of human Cystatin SN/CST1 (Accession #NP_001889.2) fused with a 6×His tag at the C-terminus.
Alternate Names: CST1
SWISS: P01037
GeneID: 1469
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.
Bio-Activity: Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value is <11.0 nM.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
