Skip to product information
1 of 1

ABclonal

Recombinant Human DAF/CD55 Protein - RP00975

Recombinant Human DAF/CD55 Protein - RP00975

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human DAF/CD55 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00975-10, RP00975-20, RP00975-50, RP00975-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD55/DAF  Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp35-Ser353) of human CD55/DAF  (Accession #NP_000565.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD55, CR, CROM, DAF, TC, CROM, DAF, TC

SWISS: P08174

GeneID: 1604

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM).

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human DAF/CD55 at 0.5 μg/mL (100 μL/well) can bind Human CD97 with a linear range of 0.3-23.8 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized APC anti-human CD55 Antibody at 1 μg/mL (25 μL/well) can bind Recombinant Human CD55 with a linear range of 0.5-3.2 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details