ABclonal
Recombinant Human DC-SIGN/CD209 Protein - RP01489
Recombinant Human DC-SIGN/CD209 Protein - RP01489
Couldn't load pickup availability
Recombinant Human DC-SIGN/CD209 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01489-10, RP01489-20, RP01489-50, RP01489-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human DC-SIGN/CD209 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln59-Ala404) of human CD209/DC-SIGN (Accession #NP_066978.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD209, CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1, CLEC4L, DC-SIGN, DC-SIGN1
SWISS: Q9NNX6-1
GeneID: 30835
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Dendritic cell (DC)-specific intercellular adhesion molecule 3 (ICAM-3) grabbing nonintegrin (DC-SIGN), also known as CD209, is a type II transmembrane protein on DCs with a C-type lectin extracellular domain, is capable of binding ICAM-3 on resting T cells in the secondary lymphoid organs, providing the initial contact between these cells during the establishment of cell-mediated immunity. It is not only a pattern recognition receptor but implicated in immunoregulation of DCs. It has an important role in mediating DC adhesion, migration, inflammation, activating primary T cell, triggering immune response and participating in immune escape of pathogens and tumors. DC-SIGN also mediates the capture and internalization of viral, bacterial, and fungal pathogens by dendritic cells, such as HIV-1, Ebola virus, cytomegalovirus, Dengue virus, and hepatitis C virus. DC-SIGN is unique in that it regulates adhesion processes, such as DC trafficking and T-cell synapse formation, as well as antigen capture. Moreover, even though several C-type lectins have been shown to bind HIV-1, DC-SIGN does not only capture HIV-1 but also protects it in early endosomes allowing HIV-1 transport by DC to lymphoid tissues, where it enhances trans infection of T cells.
Bio-Activity: Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. When 5 x 104 cells/well are added to Recombinant Human DC_x001e_SIGN/CD209 Protein coated plates (5 μg/mL with 100 μL/well), approximately 10-20% of added cells will adhere after 1 hour at 37℃.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
