ABclonal
Recombinant Human Dkk-1 Protein - RP01343
Recombinant Human Dkk-1 Protein - RP01343
Couldn't load pickup availability
Recombinant Human Dkk-1 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01343-20, RP01343-50, RP01343-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Dkk-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-His266) of human DKK-1 (Accession #NP_036374.1) fused with 6×His tag at the C-terminus.
Alternate Names: DKK1, DKK-1, SK
SWISS: O94907
GeneID: 22943
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via β-catenin mediated Pdgfrα and E-cadherin expression.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human DKK-1 at 5 μg/mL (100 μL/well) can bind Human LRP-5 with a linear range of 0.027-0.559 μg/mL.|2.Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The EC50 for this effect is approximately 95 ng/ml in the presence of 2 μg/mL of Recombinant Human Wnt3a.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
