Skip to product information
1 of 1

ABclonal

Recombinant Human DPEP1 Protein - RP01097LQ

Recombinant Human DPEP1 Protein - RP01097LQ

Regular price $147.00 CAD
Regular price Sale price $147.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human DPEP1 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP01097LQ-10, RP01097LQ-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human DPEP1 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp17-Ser385) of human Dipeptidase 1 (Accession #P16444) fused with a 6×His tag at the C-terminus.

Alternate Names: DPEP1, MBD1, MDP, RDP

SWISS: P16444

GeneID: 1800

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: This protein is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer. Two transcript variants encoding the same protein have been found for this gene.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details