Skip to product information
1 of 1

ABclonal

Recombinant Human EGF Protein - RP01030

Recombinant Human EGF Protein - RP01030

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human EGF Protein

Sizes: 50ug, 100ug

Catalogue Number: RP01030-50, RP01030-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6×His tag at the C-terminus.

Alternate Names: EGF, HOMG4, URG

SWISS: P01133

GeneID: 1950

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f

Bio-Activity: 1.Measured by its ability to stimulate EGF Receptor autophosphorylation in A431 cells.1-10 ng/mL of Recombinant Human EGF can effectively enhance EGF Receptor autophosphorylation.|2.Measured by its binding ability in a functional ELISA. Immobilized Human EGFR at 5 μg/mL (100 μL/well) can bind Human EGF with a linear range of 7-25 ng/mL. 3.Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0.065-0.26 ng/mL, corresponding to a specific activity of 3.84×10^6 -1.54×10^7units/mg.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details