Skip to product information
1 of 1

BioWorld

Recombinant Human ENA-78 (5-78a.a.) ( rHuENA-78 (CXCL5)) - PR1014

Recombinant Human ENA-78 (5-78a.a.) ( rHuENA-78 (CXCL5)) - PR1014

Regular price $260.23 CAD
Regular price Sale price $260.23 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human ENA-78 (5-78a.a.) ( rHuENA-78 (CXCL5))

Catalogue Numbers: PR1014-5, PR1014-20

Sizes: 5µg, 20µg

Source: Escherichia coli

Molecular Weight: 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.

Purity: >97% by SDS-PAGE and HPLC analyses.

Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

AA Sequence: AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Endotoxin: Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Description: Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.

View full details