Skip to product information
1 of 1

ABclonal

Recombinant Human Ephrin-A1/EFNA1 Protein - RP01425

Recombinant Human Ephrin-A1/EFNA1 Protein - RP01425

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Ephrin-A1/EFNA1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01425-10, RP01425-20, RP01425-50, RP01425-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Ephrin-A1/EFNA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser182) of human Ephrin-A1/EFNA1 (Accession #NP_004419.2) fused with a hFc tag at the C-terminus.

Alternate Names: B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4, EFNA1, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4, ephrin-A1

SWISS: P20827

GeneID: 1942

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: EPH-related receptor tyrosine kinase ligand 1 (abbreviated as Ephrin-A1) also known as ligand of eph-related kinase 1 or EFNA1, is a member of the ephrin (EPH) family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A1/EFNA1 and its Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins. Ephrin-A1 and one of its receptor EphA2 were expressed in xenograft endothelial cells and also tumor cells and play a role in human cancers, at least in part by influencing tumor neovascularization.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EphA2 at 1 μg/mL (100 μL/well) can bind Human EFNA1 with a linear range of 0.098-4.084 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details