WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Ephrin-A3/EFNA3 Protein - RP01022

Recombinant Human Ephrin-A3/EFNA3 Protein - RP01022

Regular price
$140.00
Regular price
Sale price
$140.00
Unit price
per 
Availability
Sold out

Recombinant Human Ephrin-A3/EFNA3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01022-10, RP01022-20, RP01022-50, RP01022-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin A3 (Accession #NP_004943.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: EFNA3, EFL2, EPLG3, Ehk1-L, LERK3, ephrin-A3

SWISS: P52797-1

GeneID: 1944

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Mouse EPHA6 at 1 μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-113.9 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized Mouse EPHA6 at 1μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-59 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only