Recombinant human Ephrin-A3/EFNA3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01714-10, RP01714-20, RP01714-50, RP01714-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin-A3/EFNA3 (Accession #NP_004943.1.) fused with and a 6×His tag at the C-terminus.
Alternate Names: EFL2; EPLG3; LERK3; Ehk1-L; EFNA3
SWISS: P52797-1
GeneID: 1944
Species: human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Ephrin-A3 (Ephrin A3) is also known as EFL-2, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, EFL2, EPLG3 and LERK3,which comprises the largest subfamily of receptor protein-tyrosine kinases (RTKs), and has been involved in a variety of biological processes, especially in the nervous system and in erythropoiesis, such as axon guidance and topographic map formation, synaptic plasticity, angiogenesis, and meanwhile have possible contributions to tumor growth and metastasis. Ephrin A3 is cell surface GPI-bound ligand for Eph receptors and belongs to the family of receptor tyrosine kinases. Ephrin can bind promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EFNA3(Catalog: RP01714) at 2 μg/mL (100 μL/well) can bind Human EphA3 (Catalog: RP00186) with a linear range of 0.02-2.82 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only