Skip to product information
1 of 1

ABclonal

Recombinant human Ephrin-A3/EFNA3 Protein - RP01714

Recombinant human Ephrin-A3/EFNA3 Protein - RP01714

Regular price $140.00 CAD
Regular price Sale price $140.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant human Ephrin-A3/EFNA3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01714-10, RP01714-20, RP01714-50, RP01714-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin-A3/EFNA3 (Accession #NP_004943.1.) fused with and a 6×His tag at the C-terminus.

Alternate Names: EFL2; EPLG3; LERK3; Ehk1-L; EFNA3

SWISS: P52797-1

GeneID: 1944

Species: human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Ephrin-A3 (Ephrin A3) is also known as EFL-2, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, EFL2, EPLG3 and LERK3,which comprises the largest subfamily of receptor protein-tyrosine kinases (RTKs), and has been involved in a variety of biological processes, especially in the nervous system and in erythropoiesis, such as axon guidance and topographic map formation, synaptic plasticity, angiogenesis, and meanwhile have possible contributions to tumor growth and metastasis. Ephrin A3 is cell surface GPI-bound ligand for Eph receptors and belongs to the family of receptor tyrosine kinases. Ephrin can bind promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EFNA3(Catalog: RP01714) at 2 μg/mL (100 μL/well) can bind Human EphA3 (Catalog: RP00186) with a linear range of 0.02-2.82 ng/mL.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details