ABclonal
Recombinant Human Ephrin-A5/EFNA5 Protein - RP00176
Recombinant Human Ephrin-A5/EFNA5 Protein - RP00176
Couldn't load pickup availability
Recombinant Human Ephrin-A5/EFNA5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00176-10, RP00176-20, RP00176-50, RP00176-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Ephrin-A5/EFNA5 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn203) of human Ephrin-A5/EFNA5 (Accession #NP_001953.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: EFNA5, AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS, ephrin-A5
SWISS: P52803
GeneID: 1946
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Ephrin-A5 also known as EFNA5, is a member of the Ephrin family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EPHA2 at 0.5 μg/mL (100 μL/well) can bind Human EFNA5 with a linear range of 0.02-0.67 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
