WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Ephrin-B1/EFNB1 Protein - RP00250

Recombinant Human Ephrin-B1/EFNB1 Protein - RP00250

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Ephrin-B1/EFNB1 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00250-20, RP00250-50, RP00250-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Ephrin-B1/EFNB1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 28 - Gly 232 ) of human Ephrin-B1 (Accession #NP_004420.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: EFNB1, CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2, ephrin-B1

SWISS: P98172

GeneID: 1947

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Ephrin-B1 also known as EFNB1, is a member of the ephrin family. The transmembrane- associated ephrin ligands and their Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Eph receptors and ephrins are divided into two subclasses, A and B, based on binding specificities. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse EphB2(Catalog: RP01156) at 2 μg/mL (100 μL/well) can bind Human EFNB1 (Catalog: RP00250) with a linear range of 0.01-0.54 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDG

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only