Skip to product information
1 of 1

ABclonal

Recombinant Human Erythropoietin/EPO Protein - RP01532

Recombinant Human Erythropoietin/EPO Protein - RP01532

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Erythropoietin/EPO Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01532-10, RP01532-20, RP01532-50, RP01532-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala28-Arg193) of human Erythropoietin/EPO (Accession #NP_000790.2) fused with a 6×His tag at the C-terminus.

Alternate Names: EPO, EP, MVCD2

SWISS: P01588

GeneID: 2056

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Erythropoietin is a member of the EPO / TPO family. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin can be found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. It also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. Genetic variation in erythropoietin is associated with susceptbility to microvascular complications of diabetes type 2. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. It has a longer circulating half-life in vivo. Erythropoietin is being much misused as a performance-enhancing drug in endurance athletes.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human EPO Protein at 5μg/mL (100 μL/well) can bind EPOR with a linear range of 0.12-23.83 ng/mL.|2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.03-0.12 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details