Skip to product information
1 of 1

ABclonal

Recombinant Human Erythropoietin R/EPO-R Protein - RP00111

Recombinant Human Erythropoietin R/EPO-R Protein - RP00111

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Erythropoietin R/EPO-R Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00111-10, RP00111-20, RP00111-50, RP00111-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Erythropoietin R/EPO-R Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala25-Pro250) of human EPO Receptor/EPOR (Accession #NP_000112.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: EPOR, EPO-R

SWISS: P19235

GeneID: 2057

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EPO Protein at 2μg/mL (100 μL/well) can bind EPOR with a linear range of 0.24-12.02 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,0.1mM EDTA and 0.1% CHAPS,pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details