ABclonal
Recombinant Human Estrogen receptor/ESR1 Protein - RP00815
Recombinant Human Estrogen receptor/ESR1 Protein - RP00815
Couldn't load pickup availability
Recombinant Human Estrogen receptor/ESR1 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00815-10, RP00815-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Estrogen receptor/ESR1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gln116) of human Estrogen Receptor (Accession #P03372) fused with a 6×His tag at the N-terminus.
Alternate Names: ER, ESR, ESRA, ESTRR, Era, NR3A1, ESR1, ESRα, ESR, ESRA, ESTRR, Era, NR3A1, ER alpha
SWISS: P03372
GeneID: 2099
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Estrogen Receptor is a major ligand--‐activated transcription factor belonging to the nuclear hormone receptor superfamily. Estrogen Receptor is composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but they also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
Source: E. coli
Tag: N-His
Formulation: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2Contact us for customized product form or formulation.
Antigen Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
