ABclonal
Recombinant Human FABP1/L-FABP Protein - RP00501
Recombinant Human FABP1/L-FABP Protein - RP00501
Couldn't load pickup availability
Recombinant Human FABP1/L-FABP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00501-10, RP00501-20, RP00501-50, RP00501-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FABP1/L-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2-Ile127) of human FABP1/L-FABP (Accession #P07148) fused with a His tag at the N-terminus.
Alternate Names: FABP1, FABPL, L-FABP, L-FABP
SWISS: P07148
GeneID: 2168
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Human Fatty Acid-Binding Protein 1 (FABP1) is a cytoplasm protein, which belongs to the calycin superfamilyand Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved,cytoplasmic proteins that bind long-chain fatty acids. FABP1 forms a beta-barrel structure that accommodateshydrophobic ligands in its interior. FABP1 can bind free fatty acids and their coenzyme A derivatives, bilirubin,and some other small molecules in the cytoplasm, so it can be involved in intracellular lipid transport.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
