Skip to product information
1 of 1

ABclonal

Recombinant Human FABP2/I-FABP Protein - RP02173S

Recombinant Human FABP2/I-FABP Protein - RP02173S

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FABP2/I-FABP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02173S-10, RP02173S-20, RP02173S-50, RP02173S-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Human FABP2/I-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Asp132) of Human FABP2/I-FABP (Accession #NP_000125.2) fused with a His tag at the N-terminus.

Alternate Names: FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP

SWISS: P12104

GeneID: 2169

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: FABP2/I-FABP,FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details