ABclonal
Recombinant Human FABP2/I-FABP Protein - RP02173S
Recombinant Human FABP2/I-FABP Protein - RP02173S
Couldn't load pickup availability
Recombinant Human FABP2/I-FABP Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02173S-10, RP02173S-20, RP02173S-50, RP02173S-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Recombinant Human FABP2/I-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Asp132) of Human FABP2/I-FABP (Accession #NP_000125.2) fused with a His tag at the N-terminus.
Alternate Names: FABP2, FABPI, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP
SWISS: P12104
GeneID: 2169
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FABP2/I-FABP,FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
