Skip to product information
1 of 1

ABclonal

Recombinant Human FABP3/H-FABP Protein - RP00502

Recombinant Human FABP3/H-FABP Protein - RP00502

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FABP3/H-FABP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00502-10, RP00502-20, RP00502-50, RP00502-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Human FABP3/H-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val2-Ala133) of Human FABP3/H-FABP (Accession #NP_004093.1) fused with a His tag at the N-terminus.

Alternate Names: FABP3, FABP11, MDGI, Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Heart-type fatty acid-binding protein, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP

SWISS: P05413

GeneID: 2170

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: FABP3/H-FABP,FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.Fatty acid binding protein-3 is a member of a large superfamily of lipid binding proteins that are expressed in a tissue specific manner. Although all are highly conserved in their tertiary structure, there is only modest aa identity between any two members. The FABP family members are subdivided based on organ or tissue type it was originally expressed or identified; liver- (L-FABP), intestine- (I-FABP), heart- (H-FABP), adipocyte- (A-FABP), epidermal- (E-FABP), ileal- (IL-FABP), brain- (B-FABP), myelin- (M-FABP) and testis-FABP (T-FABP). Human H-FABP, the product of the FABP3 gene, is a 132 aa cytosolic protein that shows a flattened beta -barrel structure generated by a series of antiparallel beta ‑strands and two alpha ‑helices. One molecule of FABP3 is capable of binding one long-chain fatty acid. It is suggested that ligands first bind to the outside of the molecule, and this binding subsequently induces a conformational change in the binding protein, resulting in "internalization" of the ligand. Human FABP3 is 86%, 89% and 89% aa identical to mouse, rat and canine FABP3, respectively.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details