ABclonal
Recombinant Human FAM3B/PANDER Protein - RP02181
Recombinant Human FAM3B/PANDER Protein - RP02181
Couldn't load pickup availability
Recombinant Human FAM3B/PANDER Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02181-10, RP02181-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FAM3B/PANDER Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu30-Ser235) of human FAM3B (Accession #P58499) fused with an Fc tag at the C-terminus.
Alternate Names: FAM3B, 2-21, C21orf11, C21orf76, ORF9, PANDER, PRED44
SWISS: P58499
GeneID: 54097
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FAM3B, also known as Pancreatic-derived factor (PANDER), is an islet-specific secreted cytokine specifically expressed at high levels in the islets of Langerhans of the endocrine pancreas. FAM3B can induce apoptosis of alpha and beta cells in a dose- and time-dependent manner. Previous studies showed that FAM3B regulates glucose and lipid metabolism through interaction with liver and endocrine pancreas. FAM3B silencing activates both extrinsic and intrinsic apoptotic pathways. In general, silencing FAM3B promoted p53 phosphorylation and induced p53 accumulation by decreasing Mdm2 expression, which resulted in apoptotic cell death.
Source: HEK293 cells
Tag: C-Fc
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
