Recombinant Human FAM3C Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00514-10, RP00514-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FAM3C Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln25-Asp227) of human FAM3C (Accession #Q92520) fused with a 6×His tag at the C-terminus.
Alternate Names: FAM3C, GS3786, ILEI
SWISS: Q92520
GeneID: 10447
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to theFAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancerand liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can beinvolved in retinal laminar formation and promote epithelial to mesenchymal transition.
Source: HEK293 cells
Tag: C-6×His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.
Antigen Sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only