ABclonal
Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein - RP00081
Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein - RP00081
Couldn't load pickup availability
Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00081-10, RP00081-20, RP00081-50, RP00081-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218 (R167)) of human Fc gamma RIIA/CD32a (Accession #NP_001129691.1) fused with a 6×His tag at the C-terminus.
Alternate Names: FCGR2A, CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2
SWISS: P12318
GeneID: 2212
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human CD32a at 1 μg/mL (100 μL/well) can bind biotinylated human IgG1 with a linear range of 30-250 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
