Skip to product information
1 of 1

ABclonal

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein - RP00075

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein - RP00075

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP00075-10, RP00075-50, RP00075-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala46-Pro217) of human Fc gamma RIIB/C (Accession #NP_003992.3) fused with a 6×His tag at the C-terminus.

Alternate Names: FCGR2B, CD32, CD32B, FCG2, FCGR2, IGFR2

SWISS: P31994

GeneID: 2213

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FCGR2B at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG1 with a linear range of 0.0048-2.81 μg/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2B (Catalog:RP00075) at 2μg/mL (100 μL/well) can bind FCGR2B Rabbit pAb (Catalog: A12553) with a linear range of 0.3-77.48ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details