WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a Protein - RP00066

Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a Protein - RP00066

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00066-10, RP00066-20, RP00066-50, RP00066-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly17-Gln208) of human Fc gamma RIIIA/CD16a (Accession #NP_001121065.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20, FCGR3A, CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20, Fc fragment of IgG receptor IIIa

SWISS: P08637

GeneID: 2214

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human FCGR3A at 1 μg/mL (100 μL/well) can bind FCGR3A Mouse mAb with a linear range of 0.13-6.1 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized Human FCGR3A at 1 μg/mL (100 μL/well) can bind FCGR3A Mouse mAb with a linear range of 0.06-7.1 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only