ABclonal
Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein - RP01043
Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein - RP01043
Couldn't load pickup availability
Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01043-10, RP01043-20, RP01043-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208) of human Fc gamma RIIIA/CD16a (Accession #NP_001121065.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20, FCGR3A, CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20, Fc fragment of IgG receptor IIIa
SWISS: P08637
GeneID: 2214
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FCGR3A at 1 μg/mL (100 μL/well) can bind FCGR3A Mouse mAb with a linear range of 0.13-7.9 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
