ABclonal
Recombinant Human FCAR/CD89 Protein - RP00113
Recombinant Human FCAR/CD89 Protein - RP00113
Couldn't load pickup availability
Recombinant Human FCAR/CD89 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00113-10, RP00113-20, RP00113-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FCAR/CD89 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: FCAR, CD89, CTB-61M7.2, FcalphaRI
SWISS: P24071
GeneID: 2204
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGHA1 (Catalog: RPT0023) at 5 μg/mL (100 μL/well) can bind Human CD89/FCAR (Catalog: RP00113) with a linear range of 0.01-7.4 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
