ABclonal
Recombinant Human FCRL2/FCRH2 /IRTA4 Protein - RP01984
Recombinant Human FCRL2/FCRH2 /IRTA4 Protein - RP01984
Couldn't load pickup availability
Recombinant Human FCRL2/FCRH2 /IRTA4 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01984-20, RP01984-50, RP01984-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FCRL2/FCRH2 /IRTA4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp395) of Human FCRL2/FCRH2 /IRTA4 (Accession #NP_110391.2) fused with His at the C-terminus.
Alternate Names: FCRL2, FCRH2, IFGP4, IRTA4, SPAP1, UNQ9236/PRO31998, Fc receptor-like protein 2, FcR-like protein 2, FcRL2, Fc receptor homolog 2, FcRH2, IFGP family protein 4, Immunoglobulin receptor translocation-associated protein 4, SH2 domain-containing phosphatase anchor protein 1, CD307b
SWISS: Q96LA5
GeneID: 79368
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FCRL2/FCRH2 /IRTA4, belongs to the family of glycoprotein homologs of classical immunoglobulin (Ig) Fc receptors. In human, the type I transmembrane FCRL protein family contains from three to nine immunoglobulin-like domains. Mature human FcRH2 consists of a 382 amino acid (aa) extracellular domain (ECD) with four Ig-like C2-set domains, a 21 aa transmembrane segment, and an 86 aa cytoplasmic domain with one ITAM-like, and two ITIM-like motifs. Alternate splicing of human FCRL2 may generate isoforms with N-terminal, internal, or C-terminal deletions. The gene for FcRH2 maps to the human Iq21-23 locus which is a hotspot for chromosomal translocation events associated with B cell malignancies. Although there are several Fc receptor-like genes in the mouse, none of these is a clear ortholog to human FCRL2. FCRL proteins are differentially expressed among B cells. FCRL2 is preferentially expressed on naïve and CD27+ memory B cells within the spleen, lymph nodes, tonsils, and peripheral blood. It is also expressed on most B cells in B cell chronic lymphocytic leukemia (B-CLL) patients. FCRL2 upregulation is associated with mutation of the immunoglobulin heavy chain variable (IGHV) and less aggressive forms of B-CLL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
