Skip to product information
1 of 1

ABclonal

Recombinant Human FGF-1/aFGF Protein - RP01242

Recombinant Human FGF-1/aFGF Protein - RP01242

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-1/aFGF Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01242-20, RP01242-50, RP01242-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of human FGF acidic/FGF1 (Accession #NP_000791.1) fused with a 6×His tag at the C-terminus.

Alternate Names: AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1, FGF1, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1

SWISS: P05230-1

GeneID: 2246

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FGF1 at 5 μg/mL (100 μL/well) can bind Recombinant Human FGFR3 with a linear range of 0.5-1.5 μg/mL.|2.Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 22-140 pg/mL.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM MOPS,100mM Na2SO4,10mM EDTA, pH7.9Contact us for customized product form or formulation.

Antigen Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details