Recombinant Human FGF-1/aFGF Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01242-20, RP01242-50, RP01242-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of human FGF acidic/FGF1 (Accession #NP_000791.1) fused with a 6×His tag at the C-terminus.
Alternate Names: AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1, FGF1, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
SWISS: P05230-1
GeneID: 2246
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FGF1 at 5 μg/mL (100 μL/well) can bind Recombinant Human FGFR3 with a linear range of 0.5-1.5 μg/mL.|2.Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 22-140 pg/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM MOPS,100mM Na2SO4,10mM EDTA, pH7.9Contact us for customized product form or formulation.
Antigen Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only