WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human FGF-10 Protein - RP01140

Recombinant Human FGF-10 Protein - RP01140

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human FGF-10 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01140-10, RP01140-20, RP01140-50, RP01140-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln38-Ser208) of human FGF10 (Accession #NP_004456.1).

Alternate Names: Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2, FGF10, KGF2

SWISS: O15520

GeneID: 2255

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.

Bio-Activity: 1.Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells. The ED50 for this effect is 2.08-8.32 ng/mL, corresponding to a specific activity of 1.20×10^5 ~4.81×10^5 units/mg.|2.Human stomach organoids were cultured with EGF(Cat. RP03287), FGF10(Cat. RP01140), NOG(Cat. RP01237), RSPO1(Cat. RP00071), WNT-3a(Cat. RP01618SLQ).|3.Human liver organoids were cultured with EGF(Cat. RP03287), HGF(Cat. RP01602), FGF2(Cat. RP01042), FGF10(Cat. RP01140), NOG(Cat. RP01237), RSPO1(Cat. RP00071), WNT-3a(Cat. RP01618SLQ).|4.Human kidney organoids were cultured with EGF(Cat. RP03287), FGF2(Cat. RP01042), FGF7(Cat. RP01717), FGF9(Cat. RP01710), FGF10(Cat. RP01140), IGF-(Cat. RP00996), NOG(Cat. RP01237), RSPO1(Cat. RP00071), WNT-3a(Cat. RP01618SLQ). And further, DKK-1(RP01343) was used to induce the establishment of cell polarity.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS pH7.4.

Antigen Sequence: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only