ABclonal
Recombinant Human FGF-12 Protein - RP00064
Recombinant Human FGF-12 Protein - RP00064
Couldn't load pickup availability
Recombinant Human FGF-12 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP00064-10, RP00064-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGF-12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr181) of human FGF-12 (Accession #NP_004104.3) fused with a 6×His tag at the C-terminus.
Alternate Names: FGF12, EIEE47, FGF12B, FHF1
SWISS: P61328
GeneID: 2257
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human FGFR4 at 5 μg/mL (100 μL/well) can bind recombinant human FGF12 with a linear range of 35-100 ng/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, 1mM DTT, 300mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
