Skip to product information
1 of 1

ABclonal

Recombinant Human FGF-12 Protein - RP00064

Recombinant Human FGF-12 Protein - RP00064

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-12 Protein

Sizes: 10ug, 20ug

Catalogue Number: RP00064-10, RP00064-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr181) of human FGF-12 (Accession #NP_004104.3) fused with a 6×His tag at the C-terminus.

Alternate Names: FGF12, EIEE47, FGF12B, FHF1

SWISS: P61328

GeneID: 2257

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human FGFR4 at 5 μg/mL (100 μL/well) can bind recombinant human FGF12 with a linear range of 35-100 ng/mL.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, 1mM DTT, 300mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details