Skip to product information
1 of 2

Elabscience

Recombinant Human FGF-16 protein(N-His)(active) - PKSH034158

Recombinant Human FGF-16 protein(N-His)(active) - PKSH034158

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-16 protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSH034158-20, PKSH034158-100 Citations, Manuals and MSDS Available upon request. Abbreviation: FGF-16 Target Symptom: FGFG Target Species: Human Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: O43320 Accession: O43320 Background: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation, and is required for normal cardiomyocyte proliferation and heart development. Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 31 ng/mL. The specific activity of recombinant human FGF-16 is > 3 x 104IU/mg. Sequence: MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR Purity: > 95 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 24.58 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details