Recombinant Human FGF-18 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01827-10, RP01827-20, RP01827-50, RP01827-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGF-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu28-Ala207) of human FGF-18 (Accession #NP_003853.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ZFGF5; FGF-18; FGF18
SWISS: O76093
GeneID: 8817
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fibroblast growth factor 18 (FGF18) is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that FGF18 is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Experiment datas identified FGF18 as a selective ligand for FGFR3 in limb bud mesenchymal cells, which suppressed proliferation and promoted their differentiation and production of cartilage matrix. FGF18 appears to regulate cell proliferation and differentiation positively in osteogenesis and negatively in chondrogenesis.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FGF18(Catalog: RP01827) at 10 μg/mL (100 μL/well) can bind Human FGFR4 (Catalog: RP00130) with a linear range of 27.4-393.3 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only