Recombinant Human FGF-19 Protein - RP01231

Recombinant Human FGF-19 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01231-10, RP01231-20, RP01231-50, RP01231-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe27-Lys216) of human FGF-19 (Accession #NP_005108.1) fused with a 6×His tag at the C-terminus.

Alternate Names: FGF19

SWISS: O95750

GeneID: 9965

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FGF19 at 5 μg/mL (100 μL/well) can bind Recombinant Human FGFR4 with a linear range of 0.9-3.8 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only