Skip to product information
1 of 1

ABclonal

Recombinant Human FGF-2/bFGF Protein - RP01042

Recombinant Human FGF-2/bFGF Protein - RP01042

Regular price $154.00 CAD
Regular price Sale price $154.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-2/bFGF Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01042-20, RP01042-50, RP01042-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro143-Ser288) of human FGF2 (Accession #NP_001997.5).

Alternate Names: BFGF, FGF-2, FGFB, HBGF-2, FGF2, FGF-2, FGFB, HBGF-2, Basic FGF, BFGF, fibroblast growth factor 2

SWISS: P09038-4

GeneID: 2247

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.

Bio-Activity: 1.Immobilized recombinant human FGF2 at 1 μg/mL (100 μL/well) can bind recombinant human FGFR4 with a linear range of 30-125 ng/mL.|2.Immobilized Human FGF2 at 0.5 μg/mL (100 μL/well) can bind Human GPC3 with a linear range of 7-20ng/mL.|3.Recombinant Human FGF-2 promotes the proliferation of Balb3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is 0.05-0.21 ng/mL, corresponding to a specific activity of 4.76×10^6 ~2.00×10^7 units/mg.|4.Human liver organoids were cultured with EGF(Cat. RP03287), HGF(Cat. RP01602), FGF2(Cat. RP01042), FGF10(Cat. RP01140), NOG(Cat. RP01237), RSPO1(Cat. RP00071), WNT-3a(Cat. RP01618SLQ).|5.Human kidney organoids were cultured with EGF(Cat. RP03287), FGF2(Cat. RP01042), FGF7(Cat. RP01717), FGF9(Cat. RP01710), FGF10(Cat. RP01140), IGF-(Cat. RP00996), NOG(Cat. RP01237), RSPO1(Cat. RP00071), WNT-3a(Cat. RP01618SLQ). And further, DKK-1(RP01343) was used to induce the establishment of cell polarity.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150 mM NaCl,pH7.5.Contact us for customized product form or formulation.

Antigen Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details