Recombinant Human FGF-21 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00049-10, RP00049-20, RP00049-50, RP00049-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
Alternate Names: FGF21, fibroblast growth factor 21
SWISS: Q9NSA1
GeneID: 26291
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only