Skip to product information
1 of 2

Elabscience

Recombinant Human FGF-22 protein(N-His)(active) - PKSH034161

Recombinant Human FGF-22 protein(N-His)(active) - PKSH034161

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human FGF-22 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSH034161-20, PKSH034161-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: FGF-22

Target Symptom: Fibroblast growth factor 22; FGF22

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q9HCT0

Accession: Q9HCT0

Background: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development.

Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 2 ng/mL.

Sequence: MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 20.49 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details